ZNF277 monoclonal antibody (M01), clone 1B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ZNF277 monoclonal antibody (M01), clone 1B2 Western Blot analysis of ZNF277 expression in Jurkat ( Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ZNF277 expression in transfected 293T cell line by ZNF277 monoclonal antibody (M01), clone 1B2.
Lane 1: ZNF277 transfected lysate(51.6 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of ZNF277 over-expressed 293 cell line, cotransfected with ZNF277 Validated Chimera RNAi ( Cat # H00011179-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF277 monoclonal antibody (M01), clone 1B2 (Cat # H00011179-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (56.32 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ZNF277.
Immunogen
ZNF277 (AAH20626, 1 a.a. ~ 278 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPCIFCEEHFPVAEQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQENYFLLCDVLPEDRILREELQKQRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRSVILNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYLVRLSFHNLKFDCSTANKIFLRTN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (88)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (56.32 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ZNF277 monoclonal antibody (M01), clone 1B2 Western Blot analysis of ZNF277 expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ZNF277 expression in transfected 293T cell line by ZNF277 monoclonal antibody (M01), clone 1B2.
Lane 1: ZNF277 transfected lysate(51.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ZNF277 over-expressed 293 cell line, cotransfected with ZNF277 Validated Chimera RNAi ( Cat # H00011179-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ZNF277 monoclonal antibody (M01), clone 1B2 (Cat # H00011179-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — ZNF277
Entrez GeneID
11179GeneBank Accession#
BC020626Protein Accession#
AAH20626Gene Name
ZNF277
Gene Alias
NRIF4, ZNF277P
Gene Description
zinc finger protein 277
Omim ID
605465Gene Ontology
HyperlinkOther Designations
nuclear receptor-interacting factor 4|zinc finger protein (C2H2 type) 277|zinc finger protein 277 pseudogene
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com