Product Browser

Last updated: 2017/9/24
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADAMTS7 polyclonal antibody (A01)

  • Catalog # : H00011173-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ADAMTS7.
  • Immunogen:
  • ADAMTS7 (NP_055087, 1589 a.a. ~ 1686 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • VQRRLVKCVNTQTGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011173-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • ADAMTS7
  • Gene Alias:
  • ADAM-TS7,DKFZp434H204
  • Gene Description:
  • ADAM metallopeptidase with thrombospondin type 1 motif, 7
  • Gene Summary:
  • The protein encoded by this gene is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) family. Members of this family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two C-terminal TS motifs. [provided by RefSeq
  • Other Designations:
  • COMPase,a disintegrin and metalloprotease with thrombospondin motifs-7 preproprotein,a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook