WDHD1 monoclonal antibody (M01), clone 2F10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
WDHD1 monoclonal antibody (M01), clone 2F10. Western Blot analysis of WDHD1 expression in Hela S3 NE.
Western Blot (Transfected lysate)
Western Blot analysis of WDHD1 expression in transfected 293T cell line by WDHD1 monoclonal antibody (M01), clone 2F10.
Lane 1: WDHD1 transfected lysate (Predicted MW: 10.89 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WDHD1 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WDHD1.
Immunogen
WDHD1 (NP_009017, 1031 a.a. ~ 1128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (80); Rat (80)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
WDHD1 monoclonal antibody (M01), clone 2F10. Western Blot analysis of WDHD1 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of WDHD1 expression in transfected 293T cell line by WDHD1 monoclonal antibody (M01), clone 2F10.
Lane 1: WDHD1 transfected lysate (Predicted MW: 10.89 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WDHD1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — WDHD1
Entrez GeneID
11169GeneBank Accession#
NM_007086Protein Accession#
NP_009017Gene Name
WDHD1
Gene Alias
AND-1
Gene Description
WD repeat and HMG-box DNA binding protein 1
Omim ID
608126Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
Acidic nucleoplasmic DNA-binding protein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com