Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PSIP1 monoclonal antibody (M02), clone 1C4

  • Catalog # : H00011168-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant PSIP1.
  • Immunogen:
  • PSIP1 (AAH33817, 1 a.a. ~ 50 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHET
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011168-M02
    Western Blot detection against Immunogen (31.13 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • PSIP1 monoclonal antibody (M02), clone 1C4. Western Blot analysis of PSIP1 expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PSIP1 monoclonal antibody (M02), clone 1C4. Western Blot analysis of PSIP1 expression in Hela S3 NE(Cat # L013V3 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PSIP1
  • Gene Alias:
  • DFS70,LEDGF,MGC74712,PAIP,PSIP2,p52,p75
  • Gene Description:
  • PC4 and SFRS1 interacting protein 1
  • Other Designations:
  • OTTHUMP00000022753,OTTHUMP00000022754,OTTHUMP00000022756,PC4 and SFRS1 interacting protein 2,transcriptional coactivator p52/p75
  • RSS
  • YouTube
  • Linkedin
  • Facebook