Product Browser

Last updated: 2017/9/17
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SOX21 polyclonal antibody (A01)

  • Catalog # : H00011166-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SOX21.
  • Immunogen:
  • SOX21 (NP_009015, 224 a.a. ~ 265 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011166-A01
    Western Blot detection against Immunogen (30.73 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SOX21
  • Gene Alias:
  • SOX25
  • Gene Description:
  • SRY (sex determining region Y)-box 21
  • Gene Summary:
  • SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000018558,SRY-box 21
  • RSS
  • YouTube
  • Linkedin
  • Facebook