Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NUDT3 (Human) Recombinant Protein (P01)

  • Catalog # : H00011165-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NUDT3 full-length ORF ( AAH07727, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.66
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00011165-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NUDT3
  • Gene Alias:
  • DIPP,DIPP1
  • Gene Description:
  • nudix (nucleoside diphosphate linked moiety X)-type motif 3
  • Gene Summary:
  • NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 [PubMed 9822604]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000016227,diphosphoinositol polyphosphate phosphohydrolase,nudix-type motif 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook