NUDT5 monoclonal antibody (M04), clone 2A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NUDT5 expression in transfected 293T cell line by NUDT5 monoclonal antibody (M04), clone 2A3.
Lane 1: NUDT5 transfected lysate(24.3 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUDT5 is approximately 1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of NUDT5 over-expressed 293 cell line, cotransfected with NUDT5 Validated Chimera RNAi ( Cat # H00011164-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NUDT5 monoclonal antibody (M04), clone 2A3 (Cat # H00011164-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NUDT5.
Immunogen
NUDT5 (NP_054861, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (86)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NUDT5 expression in transfected 293T cell line by NUDT5 monoclonal antibody (M04), clone 2A3.
Lane 1: NUDT5 transfected lysate(24.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUDT5 is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of NUDT5 over-expressed 293 cell line, cotransfected with NUDT5 Validated Chimera RNAi ( Cat # H00011164-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NUDT5 monoclonal antibody (M04), clone 2A3 (Cat # H00011164-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — NUDT5
Entrez GeneID
11164GeneBank Accession#
NM_014142Protein Accession#
NP_054861Gene Name
NUDT5
Gene Alias
YSA1, YSA1H, hYSAH1
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 5
Omim ID
609230Gene Ontology
HyperlinkGene Summary
Nudix hydrolases, such as NUDT5, eliminate toxic nucleotide derivatives from the cell and regulate the levels of important signaling nucleotides and their metabolites (McLennan, 1999 [PubMed 10373642]).[supplied by OMIM
Other Designations
OTTHUMP00000019112|nucleoside diphosphate linked moiety X-type motif 5|nudix-type motif 5
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com