CORO1A monoclonal antibody (M01), clone 4G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CORO1A.
Immunogen
CORO1A (NP_009005, 360 a.a. ~ 461 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.96 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CORO1A monoclonal antibody (M01), clone 4G10 Western Blot analysis of CORO1A expression in K-562 ( Cat # L009V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CORO1A on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CORO1A is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — CORO1A
Entrez GeneID
11151GeneBank Accession#
NM_007074Protein Accession#
NP_009005Gene Name
CORO1A
Gene Alias
CLABP, CLIPINA, FLJ41407, HCORO1, MGC117380, TACO, p57
Gene Description
coronin, actin binding protein, 1A
Omim ID
605000Gene Ontology
HyperlinkGene Summary
actin binding protein
Other Designations
coronin, actin-binding protein, 1A|coronin, actin-binding, 1A|coronin-1
-
Interactome
-
Publication Reference
-
An evolutionarily conserved coronin-dependent pathway defines cell population size.
Tohnyui Ndinyanka Fabrice, Christelle Bianda, Haiyan Zhang, Rajesh Jayachandran, Julie Ruer-Laventie, Mayumi Mori, Despina Moshous, Geoffrey Fucile, Alexander Schmidt, Jean Pieters.
Science Signaling 2022 Nov; 15(759):eabo5363.
Application:IF, Human, Jurkat cells.
-
Disruption of Coronin 1 Signaling in T Cells Promotes Allograft Tolerance while Maintaining Anti-Pathogen Immunity.
Jayachandran R, Gumienny A, Bolinger B, Ruehl S, Lang MJ, Fucile G, Mazumder S, Tchang V, Woischnig AK, Stiess M, Kunz G, Claudi B, Schmaler M, Siegmund K, Li J, Dertschnig S, Holländer G, Medina E, Karrer U, Moshous D, Bumann D, Khanna N, Rossi SW, Pieters J.
Immunity 2019 Jan; 50(1):152.
Application:WB, Human, Mouse, Jurkat cells, PBMCs, T cells.
-
Coronin 1 regulates cognition and behavior through modulation of cAMP/protein kinase A signaling.
Jayachandran R, Liu X, Bosedasgupta S, Muller P, Zhang CL, Moshous D, Studer V, Schneider J, Genoud C, Fossoud C, Gambino F, Khelfaoui M, Muller C, Bartholdi D, Rossez H, Stiess M, Houbaert X, Jaussi R, Frey D, Kammerer RA, Deupi X, de Villartay JP, Luthi A, Humeau Y, Pieters J.
PLoS Biology 2014 Mar; 12(3):e1001820.
Application:IF, WB-Ti, Mouse, Brain.
-
The actin-binding protein CORO1A is a novel PU.1 (SPI1)- and CEBPA-regulated gene with significantly lower expression in APL and CEBPA-mutated AML patients.
Federzoni EA, Humbert M, Valk PJ, Behre G, Leibundgut EO, Torbett BE, Fey MF, Tschan MP.
British Journal of Haematology 2012 Dec; 160(6):855.
Application:WB, Human, APL cell lines NB4 and NB4-R2 cells.
-
Coronin-1 Is Associated with Neutrophil Survival and Is Cleaved during Apoptosis: Potential Implication in Neutrophils from Cystic Fibrosis Patients.
Moriceau S, Kantari C, Mocek J, Davezac N, Gabillet J, Guerrera IC, Brouillard F, Tondelier D, Sermet-Gaudelus I, Danel C, Lenoir G, Daniel S, Edelman A, Witko-Sarsat V.
The Journal of Immunology 2009 Jun; 182(11):7254.
Application:WB, Human, Neutrophil, PLB985 cells.
-
An evolutionarily conserved coronin-dependent pathway defines cell population size.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com