Product Browser

Last updated: 2017/4/30
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PLA2G16 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00011145-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human PLA2G16 protein.
  • Immunogen:
  • PLA2G16 (AAH01387.1, 1 a.a. ~ 162 a.a) full-length human protein.
  • Sequence:
  • MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • PLA2G16 MaxPab rabbit polyclonal antibody. Western Blot analysis of PLA2G16 expression in human spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PLA2G16 MaxPab rabbit polyclonal antibody. Western Blot analysis of PLA2G16 expression in NIH/3T3.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PLA2G16 expression in transfected 293T cell line (H00011145-T02) by PLA2G16 MaxPab polyclonal antibody.

    Lane 1: PLA2G16 transfected lysate(17.9 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of PLA2G16 transfected lysate using anti-PLA2G16 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PLA2G16 purified MaxPab mouse polyclonal antibody (B01P) (H00011145-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • PLA2G16
  • Gene Alias:
  • AdPLA,H-REV107-1,HRASLS3,HREV107,HREV107-3,MGC118754
  • Gene Description:
  • phospholipase A2, group XVI
  • Other Designations:
  • HRAS-like suppressor 3,adipose-specific PLA2
  • RSS
  • YouTube
  • Linkedin
  • Facebook