Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DMC1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00011144-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DMC1 partial ORF ( NP_008999, 237 a.a. - 339 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.07
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00011144-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • DMC1
  • Gene Alias:
  • DMC1H,HsLim15,LIM15,MGC150472,MGC150473,dJ199H16.1
  • Gene Description:
  • DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
  • Gene Summary:
  • The protein encoded by this gene is essential for meiotic homologous recombination. Genetic recombination in meiosis plays an important role in generating diversity of genetic information. The product of this gene is structurally and evolutionary related to the products of the yeast RAD51 and E. coli RecA genes. Alternative splice variants of this gene have been described but their full-length nature has not been determined. [provided by RefSeq
  • Other Designations:
  • DMC1 dosage suppressor of mck1 homolog,DMC1 homologue,disrupted meiotic cDNA1, yeast, homolog of,meiotic recombination protein DMC1/LIM15 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook