DMC1 monoclonal antibody (M10), clone 4A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
DMC1 monoclonal antibody (M10), clone 4A10. Western Blot analysis of DMC1 expression in PC-12(Cat # L012V1 ).
Western Blot (Cell lysate)
DMC1 monoclonal antibody (M10), clone 4A10. Western Blot analysis of DMC1 expression in Hela S3 NE(Cat # L013V3 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DMC1 is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to DMC1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.07 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DMC1.
Immunogen
DMC1 (NP_008999, 237 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAK
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DMC1 monoclonal antibody (M10), clone 4A10. Western Blot analysis of DMC1 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
DMC1 monoclonal antibody (M10), clone 4A10. Western Blot analysis of DMC1 expression in Hela S3 NE(Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DMC1 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DMC1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — DMC1
Entrez GeneID
11144GeneBank Accession#
NM_007068Protein Accession#
NP_008999Gene Name
DMC1
Gene Alias
DMC1H, HsLim15, LIM15, MGC150472, MGC150473, dJ199H16.1
Gene Description
DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
Omim ID
602721Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is essential for meiotic homologous recombination. Genetic recombination in meiosis plays an important role in generating diversity of genetic information. The product of this gene is structurally and evolutionary related to the products of the yeast RAD51 and E. coli RecA genes. Alternative splice variants of this gene have been described but their full-length nature has not been determined. [provided by RefSeq
Other Designations
DMC1 dosage suppressor of mck1 homolog|DMC1 homologue|disrupted meiotic cDNA1, yeast, homolog of|meiotic recombination protein DMC1/LIM15 homolog
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com