Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL1RAPL1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00011141-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL1RAPL1 partial ORF ( NP_055086.1, 151 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMES
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00011141-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • IL1RAPL1
  • Gene Alias:
  • IL1R8,IL1RAPL,MRX10,MRX21,MRX34,OPHN4,TIGIRR-2
  • Gene Description:
  • interleukin 1 receptor accessory protein-like 1
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 receptor family and is similar to the interleukin 1 accessory proteins. It is most closely related to interleukin 1 receptor accessory protein-like 2 (IL1RAPL2). This gene and IL1RAPL2 are located at a region on chromosome X that is associated with X-linked non-syndromic mental retardation. Deletions and mutations in this gene were found in patients with mental retardation. This gene is expressed at a high level in post-natal brain structures involved in the hippocampal memory system, which suggests a specialized role in the physiological processes underlying memory and learning abilities. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023097,X-linked interleukin-1 receptor accessory protein-like 1,interleukin 1 receptor-8,mental retardation, X-linked 10,oligophrenin-4,three immunoglobulin domain-containing IL-1 receptor-related 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook