HIBADH purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HIBADH MaxPab polyclonal antibody. Western Blot analysis of HIBADH expression in human liver.
Western Blot (Cell lysate)
HIBADH MaxPab polyclonal antibody. Western Blot analysis of HIBADH expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of HIBADH expression in transfected 293T cell line (H00011112-T01) by HIBADH MaxPab polyclonal antibody.
Lane 1: HIBADH transfected lysate(36.96 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to HIBADH on HepG2 cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HIBADH protein.
Immunogen
HIBADH (NP_689953.1, 1 a.a. ~ 336 a.a) full-length human protein.
Sequence
MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HIBADH MaxPab polyclonal antibody. Western Blot analysis of HIBADH expression in human liver.Western Blot (Cell lysate)
HIBADH MaxPab polyclonal antibody. Western Blot analysis of HIBADH expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of HIBADH expression in transfected 293T cell line (H00011112-T01) by HIBADH MaxPab polyclonal antibody.
Lane 1: HIBADH transfected lysate(36.96 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to HIBADH on HepG2 cell. [antibody concentration 10 ug/ml] -
Gene Info — HIBADH
Entrez GeneID
11112GeneBank Accession#
NM_152740.2Protein Accession#
NP_689953.1Gene Name
HIBADH
Gene Alias
MGC40361, NS5ATP1
Gene Description
3-hydroxyisobutyrate dehydrogenase
Omim ID
608475Gene Ontology
HyperlinkGene Summary
3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM
Other Designations
3'-hydroxyisobutyrate dehydrogenase
-
Interactome
-
Pathway
-
Publication Reference
-
Population-specific expression analysis (PSEA) reveals molecular changes in diseased brain.
Kuhn A, Thu D, Waldvogel HJ, Faull RL, Luthi-Carter R.
Nature Methods 2011 Oct; 8(11):945.
Application：IHC, Human, Brain.
-
Population-specific expression analysis (PSEA) reveals molecular changes in diseased brain.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com