WDR5 monoclonal antibody (M01J), clone 2C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WDR5.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
WDR5 (NP_060058, 16 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.29 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
WDR5 monoclonal antibody (M01J), clone 2C2. Western Blot analysis of WDR5 expression in A-549.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WDR5 is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to WDR5 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — WDR5
Entrez GeneID
11091GeneBank Accession#
NM_017588Protein Accession#
NP_060058Gene Name
WDR5
Gene Alias
BIG-3, SWD3
Gene Description
WD repeat domain 5
Omim ID
609012Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
BMP2-induced 3-kb gene protein|SWD3, Set1c WD40 repeat protein, homolog|WD-repeat protein 5
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com