ADAM29 monoclonal antibody (M09), clone 3A6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ADAM29.
Immunogen
ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (58)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.34 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADAM29 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — ADAM29
Entrez GeneID
11086GeneBank Accession#
NM_014269Protein Accession#
NP_055084Gene Name
ADAM29
Gene Alias
svph1
Gene Description
ADAM metallopeptidase domain 29
Omim ID
604778Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is highly expressed in testis and may be involved in human spermatogenesis. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq
Other Designations
a disintegrin and metalloproteinase domain 29
-
Publication Reference
-
Germ cell-specific proteins AKAP4 and ASPX facilitate identification of rare spermatozoa in non-obstructive azoospermia.
Junyan Zhang, Mirzo Kanoatov, Keith Jarvi, Andree Gauthier-Fisher, Sergey I Moskovtsev, Clifford Librach, Andrei P Drabovich.
Molecular & Cellular proteomics: MCP 2023 Apr; 22(6):100556.
Application:IF, Human, Human spermatozoa.
-
ADAM29 Expression in Human Breast Cancer and its Effects on Breast Cancer Cells In Vitro.
Zhao M, Jia W, Jiang WG, Wang P, DU G, Cheng S, Song M.
Anticancer Research 2016 Mar; 36(3):1251.
Application:IHC-Fr, Human, Human breast cancer.
-
Germ cell-specific proteins AKAP4 and ASPX facilitate identification of rare spermatozoa in non-obstructive azoospermia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com