DATF1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DATF1 partial ORF ( AAH14489, 321 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.41
Interspecies Antigen Sequence
Mouse (76)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DIDO1
Entrez GeneID
11083GeneBank Accession#
BC014489Protein Accession#
AAH14489Gene Name
DIDO1
Gene Alias
BYE1, C20orf158, DATF1, DIDO2, DIDO3, DIO-1, DIO1, DKFZp434P1115, FLJ11265, KIAA0333, MGC16140, dJ885L7.8
Gene Description
death inducer-obliterator 1
Omim ID
604140Gene Ontology
HyperlinkGene Summary
Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000031518|OTTHUMP00000031519|OTTHUMP00000031520|OTTHUMP00000031521|OTTHUMP00000031522|death associated transcription factor 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com