Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DATF1 monoclonal antibody (M01A), clone 3E3

  • Catalog # : H00011083-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant DATF1.
  • Immunogen:
  • DATF1 (AAH14489, 321 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgM kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • DIDO1
  • Gene Alias:
  • BYE1,C20orf158,DATF1,DIDO2,DIDO3,DIO-1,DIO1,DKFZp434P1115,FLJ11265,KIAA0333,MGC16140,dJ885L7.8
  • Gene Description:
  • death inducer-obliterator 1
  • Gene Summary:
  • Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031518,OTTHUMP00000031519,OTTHUMP00000031520,OTTHUMP00000031521,OTTHUMP00000031522,death associated transcription factor 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook