ESM1 monoclonal antibody (M02), clone 6D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ESM1.
Immunogen
ESM1 (NP_008967, 85 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (74); Rat (74)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ESM1 expression in transfected 293T cell line by ESM1 monoclonal antibody (M02), clone 6D4.
Lane 1: ESM1 transfected lysate(20.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ESM1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ESM1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — ESM1
Entrez GeneID
11082GeneBank Accession#
NM_007036Protein Accession#
NP_008967Gene Name
ESM1
Gene Alias
endocan
Gene Description
endothelial cell-specific molecule 1
Omim ID
601521Gene Ontology
HyperlinkGene Summary
This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000122501
-
Interactome
-
Disease
-
Publication Reference
-
Endocan Knockdown Down-Regulates the Expression of Angiogenesis-Associated Genes in Il-1ß Activated Chondrocytes.
Michele Scuruchi, Federica Aliquò, Angela Avenoso, Giuseppe Mandraffino, Giovanna Vermiglio, Aurelio Minuti, Salvatore Campo, Giuseppe Maurizio Campo, Angela D'Ascola.
Biomolecules 2023 May; 13(5):851.
Application:WB-Ce, Human, Human primary chondrocytes.
-
Overexpression of Endothelial Cell-Specific Molecule 1 Correlates with Gleason Score and Expression of Androgen Receptor in Prostate Carcinoma.
Lai CY, Chen CM, Hsu WH, Hsieh YH, Liu CJ.
International Journal of Medical Sciences 2017 Sep; 14(12):1263.
Application:IHC-P, Human , Human prostate carcinoma, Human prostate tissues.
-
ESM-1 silencing decreased cell survival, migration, and invasion and modulated cell cycle progression in hepatocellular carcinoma.
Kang YH, Ji NY, Lee CI, Lee HG, Kim JW, Yeom YI, Kim DG, Yoon SK, Kim JW, Park PJ, Song EY.
Amino Acids 2011 Mar; 40(3):1003.
Application:IF, IHC-Fr, Human, Human hepatocellular carcinoma.
-
Identification of endothelial cell-specific molecule-1 as a potential serum marker for colorectal cancer.
Ji NY, Kim YH, Jang YJ, Kang YH, Lee CI, Kim JW, Yeom YI, Chun HK, Choi YH, Kim JH, Kim JW, Lee HG, Song EY.
Cancer Science 2010 Oct; 101(10):2248.
Application:IHC-P, Human, Human colorectal cancer.
-
Overexpression of Endothelial Cell Specific Molecule-1 (ESM-1) in Gastric Cancer.
Liu N, Zhang LH, Du H, Hu Y, Zhang GG, Wang XH, Li JY, Ji JF.
Annals of Surgical Oncology 2010 Oct; 17(10):2628.
Application:IHC-P, Human, Human gastric cancer.
-
Endocan Knockdown Down-Regulates the Expression of Angiogenesis-Associated Genes in Il-1ß Activated Chondrocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com