Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSF2BP (Human) Recombinant Protein (Q01)

  • Catalog # : H00011077-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HSF2BP partial ORF ( NP_008962.1, 231 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • VLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.18
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00011077-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • HSF2BP
  • Gene Alias:
  • -
  • Gene Description:
  • heat shock transcription factor 2 binding protein
  • Gene Summary:
  • HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation. [provided by RefSeq
  • Other Designations:
  • heat shock factor 2 binding protein
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook