UBE2C monoclonal antibody (M01), clone 9D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UBE2C.
Immunogen
UBE2C (NP_008950, 70 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UBE2C monoclonal antibody (M01), clone 9D3 Western Blot analysis of UBE2C expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of UBE2C expression in transfected 293T cell line by UBE2C monoclonal antibody (M01), clone 9D3.
Lane 1: UBE2C transfected lysate(19.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to UBE2C on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE2C is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to UBE2C on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — UBE2C
Entrez GeneID
11065GeneBank Accession#
NM_007019Protein Accession#
NP_008950Gene Name
UBE2C
Gene Alias
UBCH10, dJ447F3.2
Gene Description
ubiquitin-conjugating enzyme E2C
Omim ID
605574Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000031653|OTTHUMP00000031655|cyclin-selective ubiquitin carrier protein|mitotic-specific ubiquitin-conjugating enzyme|ubiquitin carrier protein E2-C|ubiquitin-protein ligase C
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
UBE2C Drives Human Cervical Cancer Progression and Is Positively Modulated by mTOR.
An-Jen Chiang, Chia-Jung Li, Kuan-Hao Tsui, Chung Chang, Yuan-Chin Ivan Chang, Li-Wen Chen, Tsung-Hsien Chang, Jim Jinn-Chyuan Sheu.
Biomolecules 2020 Dec; 11(1):37.
Application:IF, IHC-P, WB-Ce, WB-Ti, WB-Tr, Human, CaSki, CC7T, HeLa cells, Human cervical squamous cell carcinoma, Human tissue microarray.
-
UBE2C is a Potential Biomarker for Tumorigenesis and Prognosis in Tongue Squamous Cell Carcinoma.
Pei-Feng Liu, Chun-Feng Chen, Chih-Wen Shu, Hui-Min Chang, Cheng-Hsin Lee, Huei-Han Liou, Luo-Ping Ger, Chun-Lin Chen, Bor-Hwang Kang.
Diagnostics (Basel, Switzerland) 2020 Sep; 10(9):674.
Application:IHC-P, WB-Tr, Human, Ca9-22 cells, Human tongue squamous cell carcinoma, SAS cells.
-
Inhibition of Neointima Hyperplasia, Inflammation, and Reactive Oxygen Species in Balloon-Injured Arteries by HVJ Envelope Vector-Mediated Delivery of Superoxide Dismutase Gene.
Lin SL, Yeh JL, Tsai PC, Chang TH, Huang WC, Lee ST, Wassler M, Geng YJ, Sulistyowati E.
Translational Stroke Research 2018 Sep; [Epub].
Application:IHC-P, Rat, Aarotid artery.
-
The clinicopathological significance of UBE2C in breast cancer: a study based on immunohistochemistry, microarray and RNA-sequencing data.
Mo CH, Gao L, Zhu XF, Wei KL, Zeng JJ, Chen G, Feng ZB.
Cancer Cell International 2017 Sep; 17:83.
Application:IHC-P, Human, Human breast carcinoma.
-
Forkhead Box M1 positively regulates UBE2C and protects glioma cells from autophagic death.
Guo L, Ding Z, Huang N, Huang Z, Zhang N, Xia Z.
Cell Cycle (Georgetown, Tex.) 2017 Aug; 16(18):1705.
Application:IF, IHC-P, WB-Ce, WB-Ti, WB-Tr, Human, Human glioma and normal brain tissues, Ln18, MG U87, U251, U373 cells.
-
APLP2, RRM2 and PRC1: new putative markers for the differential diagnosis of thyroid follicular lesions.
Castelblanco E, Zafón C, Maravall J, Gallel P, Martinez M, Capel I, Bella-Cueto MR, Halperin I, Temprana-Salvador J, Iglesias C, Puig-Domingo M, Robledo M, Matias-Guiu X, Mauricio D.
Thyroid : Official Journal of the American Thyroid Association 2017 Jan; 27(1):59.
Application:IHC-P, Human, Human thyroid tumors.
-
Ubiquitin-Conjugating Enzyme UBE2C Is Highly Expressed in Breast Microcalcification Lesions.
Chou CP, Huang NC, Jhuang SJ, Pan HB, Peng NJ, Cheng JT, Chen CF, Chen JJ, Chang TH.
PLoS One 2014 Apr; 9(4):e93934.
Application:IHC-P, WB-Ce, WB-Tr, Human, Breast, MCF-7, MDA MB-231 cells.
-
Oligonucleotide Microarray Identifies Genes Differentially Expressed during Tumorigenesis of DMBA-Induced Pancreatic Cancer in Rats.
Guo JC, Li J, Yang YC, Zhou L, Zhang TP, Zhao YP.
PLoS One 2013 Dec; 8(12):e82910.
Application:IHC, Rat, Pancreas.
-
UBE2C is a marker of unfavorable prognosis in bladder cancer after radical cystectomy.
Morikawa T, Kawai T, Abe H, Kume H, Homma Y, Fukayama M.
International Journal of Clinical and Experimental Pathology 2013 Jun; 6(7):1367.
Application:IHC, Human, Bladder.
-
Multicenter validation of cyclin D1, MCM7, TRIM29, and UBE2C as prognostic protein markers in non-muscle-invasive bladder cancer.
Fristrup N, Birkenkamp-Demtröder K, Reinert T, Sanchez-Carbayo M, Segersten U, Malmström PU, Palou J, Alvarez-Múgica M, Pan CC, Ulhøi BP, Borre M, Ørntoft TF, Dyrskjøt L.
The American Journal of Pathology 2013 Feb; 182(2):339.
Application:IHC, Human, Bladder Cancer.
-
A study of UbcH10 expression and its association with recurrence of meningiomas.
Jiang L, Wang T, Bao Y, Qian J, Wu XJ, Hu GH, Lu YC.
Journal of Surgical Oncology 2012 Sep; 106(3):327.
Application:IHC-P, Human, Human meningiomas.
-
Association of clinicopathological features with UbcH10 expression in colorectal cancer.
Chen S, Chen Y, Hu C, Jing H, Cao Y, Liu X.
Journal of Cancer Research and Clinical Oncology 2010 Mar; 136(3):419.
Application:IHC, WB, Human, Colorectal tissue, HT-29 cells.
-
Expression of ubiquitin-conjugating enzyme E2C/UbcH10 in astrocytic tumors.
Jiang L, Huang CG, Lu YC, Luo C, Hu GH, Liu HM, Chen JX, Han HX.
Brain Research 2008 Jan; 1201:161.
Application:IHC-P, Human, Human astrocytic tumors.
-
UBE2C Drives Human Cervical Cancer Progression and Is Positively Modulated by mTOR.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com