Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBE2C polyclonal antibody (A02)

  • Catalog # : H00011065-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant UBE2C.
  • Immunogen:
  • UBE2C (AAH50736, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011065-A02
    Western Blot detection against Immunogen (45.8 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • UBE2C polyclonal antibody (A02), Lot # 051122JC01 Western Blot analysis of UBE2C expression in IMR-32 ( Cat # L008V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • UBE2C
  • Gene Alias:
  • UBCH10,dJ447F3.2
  • Gene Description:
  • ubiquitin-conjugating enzyme E2C
  • Gene Summary:
  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000031653,OTTHUMP00000031655,cyclin-selective ubiquitin carrier protein,mitotic-specific ubiquitin-conjugating enzyme,ubiquitin carrier protein E2-C,ubiquitin-protein ligase C
  • RSS
  • YouTube
  • Linkedin
  • Facebook