WWP2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of WWP2 expression in transfected 293T cell line (H00011060-T02) by WWP2 MaxPab polyclonal antibody.
Lane 1: WWP2 transfected lysate(35.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human WWP2 protein.
Immunogen
WWP2 (NP_955455.1, 1 a.a. ~ 335 a.a) full-length human protein.
Sequence
MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPG
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of WWP2 expression in transfected 293T cell line (H00011060-T02) by WWP2 MaxPab polyclonal antibody.
Lane 1: WWP2 transfected lysate(35.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — WWP2
Entrez GeneID
11060GeneBank Accession#
NM_199423.1Protein Accession#
NP_955455.1Gene Name
WWP2
Gene Alias
AIP2, WWp2-like
Gene Description
WW domain containing E3 ubiquitin protein ligase 2
Omim ID
602308Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. The encoded protein contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
Nedd-4-like ubiquitin-protein ligase|OTTHUMP00000174895|WW domain-containing protein 2|atrophin-1 interacting protein 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com