WWP1 monoclonal antibody (M01), clone 1A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WWP1.
Immunogen
WWP1 (NP_008944, 152 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of WWP1 expression in transfected 293T cell line by WWP1 monoclonal antibody (M01), clone 1A7.
Lane 1: WWP1 transfected lysate(105.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to WWP1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of WWP1 transfected lysate using anti-WWP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with WWP1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WWP1 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to WWP1 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — WWP1
Entrez GeneID
11059GeneBank Accession#
NM_007013Protein Accession#
NP_008944Gene Name
WWP1
Gene Alias
AIP5, DKFZp434D2111, Tiul1, hSDRP1
Gene Description
WW domain containing E3 ubiquitin protein ligase 1
Omim ID
602307Gene Ontology
HyperlinkGene Summary
WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. [provided by RefSeq
Other Designations
Nedd-4-like ubiquitin-protein ligase|TGIF-interacting ubiquitin ligase 1|atrophin-1 interacting protein 5
-
Interactome
-
Pathway
-
Publication Reference
-
Inhibition of HECT E3 ligases as potential therapy for COVID-19.
Giuseppe Novelli, Jing Liu, Michela Biancolella, Tonino Alonzi, Antonio Novelli, J J Patten, Dario Cocciadiferro, Emanuele Agolini, Vito Luigi Colona, Barbara Rizzacasa, Rosalinda Giannini, Benedetta Bigio, Delia Goletti, Maria Rosaria Capobianchi, Sandro Grelli, Justin Mann, Trevor D McKee, Ke Cheng, Fatima Amanat, Florian Krammer, Andrea Guarracino, Gerardo Pepe, Carlo Tomino, Yacine Tandjaoui-Lambiotte, Yurdagul Uzunhan, Sarah Tubiana, Jade Ghosn, COVID Human Genetic Effort; French COVID Coho
Cell Death & Disease 2021 Mar; 12(4):310.
Application:IHC-P, Mouse, Mouse lung.
-
USP3 promotes breast cancer cell proliferation by deubiquitinating KLF5.
Wu Y, Qin J, Li F, Yang C, Li Z, Zhou Z, Zhang H, Li Y, Wang X, Liu R, Tao Q, Chen W, Chen C.
The Journal of Biological Chemistry 2019 Nov; 294(47):17837.
Application:WB-Tr, Human, HEK 293T cells.
-
USP9X Deubiquitylates DVL2 to Regulate WNT Pathway Specification.
Nielsen CP, Jernigan KK, Diggins NL, Webb DJ, MacGurn JA.
Cell Reports 2019 Jul; 28(4):1074.
Application:IP, WB, Human, MDA-MB-231 cells.
-
High expression of WWP1 predicts poor prognosis and associates with tumor progression in human colorectal cancer.
Chen JJ, Zhang W.
American Journal of Cancer Research 2018 Feb; 8(2):256.
Application:IHC, WB, Human, SW480, HCT116, SW620, HT29, LoVo, NCM460 cells.
-
Cardiomyocyte-specific overexpression of the ubiquitin ligase Wwp1 contributes to reduction in connexin 43 and arrhythmogenesis.
Basheer WA, Harris BS, Mentrup HL, Abreha M, Thames EL, Lea JB, Swing DA, Copeland NG, Jenkins NA, Price RL, Matesic LE.
Journal of Molecular and Cellular Cardiology 2015 Nov; 88:1.
Application:IF, Human, Heart, Left ventricle.
-
Functional Characterization of a WWP1/Tiul1 Tumor-derived Mutant Reveals a Paradigm of Its Constitutive Activation in Human Cancer.
Courivaud T, Ferrand N, Elkhattouti A, Kumar S, Levy L, Ferrigno O, Atfi A, Prunier C.
The Journal of Biological Chemistry 2015 Aug; 290(34):21007.
Application:WB-Ce, WB-Tr, Human, HEK 293, MCF-7, HeLa cells.
-
WWP2-WWP1 Ubiquitin Ligase Complex Coordinated by PPM1G Maintains the Balance Between Cellular p73 and ΔNp73 Levels.
Chaudhary N, Maddika S.
Molecular and Cellular Biology 2014 Oct; 34(19):3754.
Application:WB-Tr, Human, HeLa cells.
-
Knockdown of WWP1 inhibits growth and induces apoptosis in hepatoma carcinoma cells through the activation of caspase3 and p53.
Cheng Q, Cao X, Yuan F, Li G, Tong T.
Biochemical and Biophysical Research Communications 2014 Jun; 448(3):248.
Application:WB-Ti, WB-Tr, Human, Hepatoma carcinoma, MHCC97H, SMMC7721 cells.
-
WWP1 delays cellular senescence by promoting p27Kip1 degradation in human diploid fibroblasts.
Cao X, Xue L, Han L, Ma L, Chen T, Tong T.
The Journal of Biological Chemistry 2011 Sep; 286(38):33447.
Application:IP, WB, Human, 2BS, HeLa, WI38 cells.
-
The E3 ubiquitin ligase WWP1 regulates ?GNp63-dependent transcription through Lys63 linkages.
Peschiaroli A, Scialpi F, Bernassola F, Sherbini el SE, Melino G.
Biochemical and Biophysical Research Communications 2010 Nov; 402(2):425.
Application:WB-Tr, Human, JHU-022 cells.
-
Endogenous spartin (SPG20) is recruited to endosomes and lipid droplets and interacts with the ubiquitin E3 ligases AIP4 and AIP5.
Edwards TL, Clowes VE, Tsang HT, Connell JW, Sanderson CM, Luzio JP, Reid E.
The Biochemical Journal 2009 Sep; 423(1):31.
Application:WB-Ce, WB-Tr, Human, HeLa cells.
-
Inhibition of HECT E3 ligases as potential therapy for COVID-19.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com