Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

WWP1 polyclonal antibody (A01)

  • Catalog # : H00011059-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant WWP1.
  • Immunogen:
  • WWP1 (NP_008944, 152 a.a. ~ 260 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00011059-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • WWP1
  • Gene Alias:
  • AIP5,DKFZp434D2111,Tiul1,hSDRP1
  • Gene Description:
  • WW domain containing E3 ubiquitin protein ligase 1
  • Gene Summary:
  • WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. [provided by RefSeq
  • Other Designations:
  • Nedd-4-like ubiquitin-protein ligase,TGIF-interacting ubiquitin ligase 1,atrophin-1 interacting protein 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook