Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NUDT21 (Human) Recombinant Protein (Q01)

  • Catalog # : H00011051-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NUDT21 partial ORF ( AAH01403.1, 144 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • CIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.11
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00011051-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NUDT21
  • Gene Alias:
  • CFIM25,CPSF5,DKFZp686H1588
  • Gene Description:
  • nudix (nucleoside diphosphate linked moiety X)-type motif 21
  • Gene Summary:
  • The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq
  • Other Designations:
  • cleavage and polyadenylation specific factor 5,cleavage and polyadenylation specific factor 5, 25 kD subunit,cleavage and polyadenylation specific factor 5, 25 kDa,pre-mRNA cleavage factor Im (25kD),pre-mRNA cleavage factor Im, 25kD subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook