CPSF5 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CPSF5 full-length ORF ( AAH01403, 1 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
50.71
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NUDT21
Entrez GeneID
11051GeneBank Accession#
BC001403Protein Accession#
AAH01403Gene Name
NUDT21
Gene Alias
CFIM25, CPSF5, DKFZp686H1588
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 21
Omim ID
604978Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq
Other Designations
cleavage and polyadenylation specific factor 5|cleavage and polyadenylation specific factor 5, 25 kD subunit|cleavage and polyadenylation specific factor 5, 25 kDa|pre-mRNA cleavage factor Im (25kD)|pre-mRNA cleavage factor Im, 25kD subunit
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com