SLC35D2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SLC35D2 partial ORF ( NP_008932, 74 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
VSKLNKIIHFPDFDKKIPVKLFPLPLLYVGNHISGLSSTSKLSLPMFTVLRKFTIPLT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.12
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — SLC35D2
Entrez GeneID
11046GeneBank Accession#
NM_007001Protein Accession#
NP_008932Gene Name
SLC35D2
Gene Alias
HFRC1, MGC117215, MGC142139, SQV7L, UGTrel8, hfrc
Gene Description
solute carrier family 35, member D2
Omim ID
609182Gene Ontology
HyperlinkGene Summary
Nucleotide sugars, which are synthesized in the cytosol or the nucleus, are high-energy donor substrates for glycosyltransferases located in the lumen of the endoplasmic reticulum and Golgi apparatus. Translocation of nucleotide sugars from the cytosol into the lumen compartment is mediated by specific nucleotide sugar transporters, such as SLC35D2 (Suda et al., 2004 [PubMed 15082721]).[supplied by OMIM
Other Designations
OTTHUMP00000021719|UDP-N-acetylglucosamine transporter|fringe connection
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com