DSTN (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human DSTN partial ORF ( NP_006861, 56 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.51
Interspecies Antigen Sequence
Mouse (95)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — DSTN
Entrez GeneID
11034GeneBank Accession#
NM_006870Protein Accession#
NP_006861Gene Name
DSTN
Gene Alias
ACTDP, ADF, bA462D18.2
Gene Description
destrin (actin depolymerizing factor)
Omim ID
609114Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the actin-binding proteins ADF family. This family of proteins is responsible for enhancing the turnover rate of actin in vivo. This gene encodes the actin depolymerizing protein that severs actin filaments (F-actin) and binds to actin monomers (G-actin). Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000030335|bA462D18.2 (destrin (actin depolymerizing factor ADF) (ACTDP))|destrin
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com