LILRA2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LILRA2 partial ORF ( NP_006857, 322 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMG
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
32.56
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — LILRA2
Entrez GeneID
11027GeneBank Accession#
NM_006866Protein Accession#
NP_006857Gene Name
LILRA2
Gene Alias
CD85H, ILT1, LIR-7, LIR7
Gene Description
leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2
Omim ID
604812Gene Ontology
HyperlinkGene Summary
Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function (see, e.g., LILRB1, MIM 604811). LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3; MIM 604818) lacks a transmembrane region and is presumed to be a soluble receptor.[supplied by OMIM
Other Designations
leukocyte immunoglobulin-like receptor 7|leukocyte immunoglobulin-like receptor subfamily A member 2 soluble
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com