LILRA2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of LILRA2 expression in transfected 293T cell line (H00011027-T01) by LILRA2 MaxPab polyclonal antibody.
Lane 1: LILRA2 transfected lysate(51.26 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human LILRA2 protein.
Immunogen
LILRA2 (NP_006857.1, 1 a.a. ~ 466 a.a) full-length human protein.
Sequence
MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSASLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LILRA2 expression in transfected 293T cell line (H00011027-T01) by LILRA2 MaxPab polyclonal antibody.
Lane 1: LILRA2 transfected lysate(51.26 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — LILRA2
Entrez GeneID
11027GeneBank Accession#
NM_006866.1Protein Accession#
NP_006857.1Gene Name
LILRA2
Gene Alias
CD85H, ILT1, LIR-7, LIR7
Gene Description
leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2
Omim ID
604812Gene Ontology
HyperlinkGene Summary
Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function (see, e.g., LILRB1, MIM 604811). LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3; MIM 604818) lacks a transmembrane region and is presumed to be a soluble receptor.[supplied by OMIM
Other Designations
leukocyte immunoglobulin-like receptor 7|leukocyte immunoglobulin-like receptor subfamily A member 2 soluble
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com