LILRA3 monoclonal antibody (M01), clone 2E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant LILRA3.
Immunogen
LILRA3 (AAH28208.1, 1 a.a. ~ 439 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (74.03 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LILRA3 expression in transfected 293T cell line by LILRA3 monoclonal antibody (M01), clone 2E9.
Lane 1: LILRA3 transfected lysate(50.485 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — LILRA3
Entrez GeneID
11026GeneBank Accession#
BC028208Protein Accession#
AAH28208.1Gene Name
LILRA3
Gene Alias
CD85E, HM31, HM43, ILT6, LIR-4, LIR4, e3
Gene Description
leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3
Omim ID
604818Gene Ontology
HyperlinkGene Summary
Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function (see, e.g., LILRB1, MIM 604811). LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades (see LILRA1, MIM 604810). One member of subfamily A (LILRA3) lacks a transmembrane region and is presumed to be a soluble receptor (Borges et al., 1997 [PubMed 9548455]).[supplied by OMIM
Other Designations
OTTHUMP00000067955|OTTHUMP00000067957|leucocyte immunoglobulin-like receptor|leukocyte immunoglobulin-like receptor 4|leukocyte immunoglobulin-like receptor A3
-
Interactome
-
Disease
-
Publication Reference
-
Nuclear Leukocyte Immunoglobulin-like Receptor A3 Is Monomeric and Is Involved in Multiple Layers of Regulated Gene Expression and Translation.
Hongyan An, Alexander Richardson, Poornima Rajasekariah, Ling Zhong, Bentotage Samitha M Fernando, Alexander Macmillan, Enrico Klotzsch, Katherine Bryant, Nadeem O Kaakoush, Nicodemus Tedla.
Journal of Proteome Research 2021 Jun; 20(6):3078.
Application:WB-Tr, Human, HEK 293T cells, Human primary monocytes.
-
TLR8 regulation of LILRA3 in monocytes is abrogated in human immunodeficiency virus infection and correlates to CD4 counts and virus loads.
Low HZ, Ahrenstorf G, Pommerenke C, Habermann N, Schughart K, Ordóñez D, Stripecke R, Wilk E, Witte T.
Retrovirology 2016 Mar; 13:15.
Application:WB-Ce, Human, PBMCs.
-
Serum Leukocyte Immunoglobulin-Like Receptor A3 (LILRA3) Is Increased in Patients with Multiple Sclerosis and Is a Strong Independent Indicator of Disease Severity; 6.7kbp LILRA3 Gene Deletion Is Not Associated with Diseases Susceptibility.
An H, Lim C, Guillemin GJ, Vollmer-Conna U, Rawlinson W, Bryant K, Tedla N.
PloS One 2016 Feb; 11(2):1.
Application:ELISA, Human, Serum.
-
Soluble LILRA3 promotes neurite outgrowth and synapses formation through high affinity interaction with Nogo 66.
An H, Brettle M, Lee T, Heng B, Lim CK, Guillemin GJ, Lord MS, Klotzsch E, Geczy CL, Bryant K, Fath T, Tedla N.
Journal of Cell Science 2016 Mar; 129(6):1198.
Application:WB-Re, Recombinant protein.
-
Glycosylation in a mammalian expression system is critical for the production of functionally active leukocyte immunoglobulin-like receptor A3 protein.
Lee TH, Mitchell A, Liu Lau S, An H, Rajeaskariah P, Wasinger V, Raftery M, Bryant K, Tedla N.
The Journal of Biological Chemistry 2013 Nov; 288(46):32873.
Application:WB-Ce, Human, 293T cells.
-
Soluble LILRA3, a Potential Natural Antiinflammatory Protein, Is Increased in Patients with Rheumatoid Arthritis and Is Tightly Regulated by Interleukin 10, Tumor Necrosis Factor-{alpha}, and Interferon-{gamma}.
An H, Chandra V, Piraino B, Borges L, Geczy C, McNeil HP, Bryant K, Tedla N.
The Journal of Rheumatology 2010 Aug; 37(8):1596.
Application:ELISA, WB, Human, Human serum, Recombinant protein.
-
Nuclear Leukocyte Immunoglobulin-like Receptor A3 Is Monomeric and Is Involved in Multiple Layers of Regulated Gene Expression and Translation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com