Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GLIPR1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00011010-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GLIPR1 partial ORF ( NP_006842, 23 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.21
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00011010-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • GLIPR1
  • Gene Alias:
  • CRISP7,GLIPR,RTVP1
  • Gene Description:
  • GLI pathogenesis-related 1
  • Gene Summary:
  • This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
  • Other Designations:
  • GLI pathogenesis-related 1 (glioma),glioma pathogenesis-related protein 1,related to testis-specific, vespid, and pathogenesis proteins 1,testes-specific vespid and pathogenesis protein 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook