GLIPR1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GLIPR1 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of GLIPR1 expression in U-2 OS ( Cat # L022V1 ).
Western Blot detection against Immunogen (34.58 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant GLIPR1.
Immunogen
GLIPR1 (NP_006842, 23 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Sequence
NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (68); Rat (63)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.58 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GLIPR1 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of GLIPR1 expression in U-2 OS ( Cat # L022V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — GLIPR1
Entrez GeneID
11010GeneBank Accession#
NM_006851Protein Accession#
NP_006842Gene Name
GLIPR1
Gene Alias
CRISP7, GLIPR, RTVP1
Gene Description
GLI pathogenesis-related 1
Omim ID
602692Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
Other Designations
GLI pathogenesis-related 1 (glioma)|glioma pathogenesis-related protein 1|related to testis-specific, vespid, and pathogenesis proteins 1|testes-specific vespid and pathogenesis protein 1
-
Interactome
-
Disease
-
Publication Reference
-
GLIPR1 expression is reduced in multiple myeloma but is not a tumour suppressor in mice.
Friend N, Noll JE, Opperman KS, Clark KC, Mrozik KM, Vandyke K, Hewett DR, Zannettino ACW.
PLoS One 2020 Jan; 15(1):e0228408.
Application：WB-Ti, WB-Tr, Human, Mouse, 5TGM1 cells, Bone marrow, H929 cells, Spleens.
-
GLIPR1 expression is reduced in multiple myeloma but is not a tumour suppressor in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com