KIF2C monoclonal antibody (M01), clone 1G2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
KIF2C monoclonal antibody (M01), clone 1G2 Western Blot analysis of KIF2C expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Transfected lysate)
Western Blot analysis of KIF2C expression in transfected 293T cell line by KIF2C monoclonal antibody (M01), clone 1G2.
Lane 1: KIF2C transfected lysate(81.3 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of KIF2C transfected lysate using anti-KIF2C monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KIF2C MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KIF2C is approximately 0.1ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of KIF2C over-expressed 293 cell line, cotransfected with KIF2C Validated Chimera RNAi ( Cat # H00011004-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KIF2C monoclonal antibody (M01), clone 1G2 (Cat # H00011004-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Immunofluorescence
Immunofluorescence of monoclonal antibody to KIF2C on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KIF2C.
Immunogen
KIF2C (AAH14924, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
KIF2C monoclonal antibody (M01), clone 1G2 Western Blot analysis of KIF2C expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of KIF2C expression in transfected 293T cell line by KIF2C monoclonal antibody (M01), clone 1G2.
Lane 1: KIF2C transfected lysate(81.3 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of KIF2C transfected lysate using anti-KIF2C monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KIF2C MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KIF2C is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of KIF2C over-expressed 293 cell line, cotransfected with KIF2C Validated Chimera RNAi ( Cat # H00011004-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KIF2C monoclonal antibody (M01), clone 1G2 (Cat # H00011004-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to KIF2C on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — KIF2C
Entrez GeneID
11004GeneBank Accession#
BC014924Protein Accession#
AAH14924Gene Name
KIF2C
Gene Alias
KNSL6, MCAK
Gene Description
kinesin family member 2C
Omim ID
604538Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation. [provided by RefSeq
Other Designations
OTTHUMP00000010066|kinesin-like 6|mitotic centromere-associated kinesin
-
Interactome
-
Publication Reference
-
Molecular basis of vasohibins-mediated detyrosination and its impact on spindle function and mitosis.
Liao S, Rajendraprasad G, Wang N, Eibes S, Gao J, Yu H, Wu G, Tu X, Huang H, Barisic M, Xu C.
Cell Research 2019 Jul; 29(7):533.
Application：WB-Tr, Human, U-2 OS cells.
-
Septin filament coalignment with microtubules depends on SEPT9_i1 and tubulin polyglutamylation, and is an early feature of acquired cell resistance to paclitaxel.
Targa B, Klipfel L, Cantaloube I, Salameh J, Benoit B, Poüs C, Baillet A.
Cell Death & Disease 2019 Jan; 10(2):54.
Application：WB-Tr, Human, MDA-MB 231, RPE-1 cells.
-
Mitotic Rounding Alters Cell Geometry to Ensure Efficient Bipolar Spindle Formation.
Lancaster OM, Le Berre M, Dimitracopoulos A, Bonazzi D, Zlotek-Zlotkiewicz E, Picone R, Duke T, Piel M, Baum B.
Developmental Cell 2013 May; 25(3):270.
Application：WB-Tr, Human, HeLa cells.
-
Functional and spatial regulation of the mitotic centromere-associated kinesin by cyclin-dependent kinase 1.
Sanhaji M, Friel CT, Kreis NN, Kramer A, Martin C, Howard J, Strebhardt K, Yuan J.
Molecular and Cellular Biology 2010 Jun; 30(11):2594.
Application：WB-Tr, Human, HeLa cells.
-
Molecular basis of vasohibins-mediated detyrosination and its impact on spindle function and mitosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com