SLC27A4 monoclonal antibody (M01), clone 1F4-1B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant SLC27A4.
Immunogen
SLC27A4 (AAH09959.1, 1 a.a. ~ 237 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPLTLSTLLQPGRIWTGRRAAEPTPGHNAAWSLSGGGAAVLQAGAETALDPGGILPVVPLLGIWRLALHPGLHQDHQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.81 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SLC27A4 monoclonal antibody (M01), clone 1F4-1B10 Western Blot analysis of SLC27A4 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SLC27A4 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — SLC27A4
Entrez GeneID
10999GeneBank Accession#
BC009959Protein Accession#
AAH09959.1Gene Name
SLC27A4
Gene Alias
ACSVL4, FATP4
Gene Description
solute carrier family 27 (fatty acid transporter), member 4
Omim ID
604194Gene Ontology
HyperlinkGene Summary
O
Other Designations
OTTHUMP00000022264|fatty acid transport protein 4
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Adipocyte-induced CD36 expression drives ovarian cancer progression and metastasis.
Ladanyi A, Mukherjee A, Kenny HA, Johnson A, Mitra AK, Sundaresan S, Nieman KM, Pascual G, Benitah SA, Montag A, Yamada SD, Abumrad NA, Lengyel E.
Oncogene 2018 Apr; 37(17):2285.
Application:IF, WB, Human, HeyAB, SKOV3ip1, OVCAR-5 cells.
-
Placental Lipid Transport.
Dubé E, Desparois G, Lafond J.
Methods in Molecular Biology (Clifton, N.J.) 2017 Sep; 1710:305.
Application:WB-Ti, Human, Human placenta.
-
The overall fatty acid absorption controlled by basolateral chylomicron excretion under regulation of p-JNK1.
Stremmel W, Staffer S, Wannhoff A, Pathil A.
Biochimica et Biophysica Acta 2017 Jun; 1862(9):917.
Application:WB-Ce, Human, Caco-2 cells.
-
luence of high fat diet and resveratrol supplementation on placental fatty acid uptake in the Japanese macaque.
O'Tierney-Ginn P, Roberts V, Gillingham M, Walker J, Glazebrook PA, Thornburg KL, Grove K, Frias AE.
Placenta 2015 Aug; 36(8):903.
Application:WB-Ti, Japanese macaques, Placental.
-
Palmitate activation by fatty acid transport protein 4 as a model system for hepatocellular apoptosis and steatosis.
Seessle J, Liebisch G, Schmitz G, Stremmel W, Chamulitrat W.
Biochimica et Biophysica Acta 2015 May; 1851(5):549.
Application:IFF, WB, WB-Tr, Human, Mouse, Huh-7 cells, Livers.
-
Plasma membrane phospholipase A2 controls hepatocellular fatty acid uptake and is responsive to pharmacological modulation: implications for nonalcoholic steatohepatitis.
Stremmel W, Staffer S, Wannhoff A, Pathil A, Chamulitrat W.
FASEB Journal 2014 Jul; 28(7):3159.
Application:WB-Ce, Human, HepG2 cells.
-
Interactions between FATP4 and ichthyin in epidermal lipid processing may provide clues to the pathogenesis of autosomal recessive congenital ichthyosis.
Li H, Vahlquist A, Torma H.
Journal of Dermatological Science 2012 Dec; 69(3):195.
Application:IF, Human, Skin.
-
Modulation of fatty acid transport and metabolism by maternal obesity in the human full-term placenta.
Dubé E, Gravel A, Martin C, Desparois G, Moussa I, Ethier-Chiasson M, Forest JC, Giguère Y, Masse A, Lafond J.
Biology of Reproduction 2012 Jul; 87(1):14.
Application:WB-Ti, Human, Human placental tissues.
-
Adipokines promote lipotoxicity in human skeletal muscle cells.
Taube A, Lambernd S, van Echten-Deckert G, Eckardt K, Eckel J.
Archives of Physiology and Biochemistry 2012 Jul; 118(3):92.
Application:WB, Human, SkMC cells.
-
Mutations in the Fatty Acid Transport Protein 4 Gene Cause the Ichthyosis Prematurity Syndrome.
Klar J, Schweiger M, Zimmerman R, Zechner R, Li H, Torma H, Vahlquist A, Bouadjar B, Dahl N, Fischer J.
American Journal of Human Genetics 2009 Aug; 78(6):561.
Application:IF, IHC, WB-Ti, Human, Human skin biopsies.
-
Fatty acid transport and activation and the expression patterns of genes involved in fatty acid trafficking.
Sandoval A, Fraisl P, Arias-Barrau E, DiRusso CD, Singer D, Sealls W, Black PN.
Archives of Biochemistry and Biophysics 2008 Jun; 477(2):363.
Application:WB-Ce, Humna, Caco-2, HepG2 cells.
-
Adipocyte-induced CD36 expression drives ovarian cancer progression and metastasis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com