Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC27A5 (Human) Recombinant Protein (Q01)

  • Catalog # : H00010998-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SLC27A5 partial ORF ( NP_036386, 90 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DVIFLAKILHLGLKIRGCLSRQPPDTFVDAFERRARAQPGRALLVWTGPGAGSVTFGELDARACQAAWALKAELGDPASLCAGEPT
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010998-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • SLC27A5
  • Gene Alias:
  • ACSB,ACSVL6,FACVL3,FATP5,FLJ22987,VLACSR,VLCS-H2,VLCSH2
  • Gene Description:
  • solute carrier family 27 (fatty acid transporter), member 5
  • Gene Summary:
  • The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons. It is expressed in liver and associated with endoplasmic reticulum but not with peroxisomes. Its primary role is in fatty acid elongation or complex lipid synthesis rather than in degradation. This gene has a mouse ortholog. [provided by RefSeq
  • Other Designations:
  • fatty-acid-Coenzyme A ligase, very long-chain 3,very long-chain acyl-CoA synthetase homolog 2,very long-chain acyl-CoA synthetase-related protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook