Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SLC27A5 polyclonal antibody (A01)

  • Catalog # : H00010998-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SLC27A5.
  • Immunogen:
  • SLC27A5 (NP_036386, 90 a.a. ~ 175 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DVIFLAKILHLGLKIRGCLSRQPPDTFVDAFERRARAQPGRALLVWTGPGAGSVTFGELDARACQAAWALKAELGDPASLCAGEPT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010998-A01
    Western Blot detection against Immunogen (35.57 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • SLC27A5 polyclonal antibody (A01), Lot # 060703JCS1. Western Blot analysis of SLC27A5 expression in human liver.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SLC27A5
  • Gene Alias:
  • ACSB,ACSVL6,FACVL3,FATP5,FLJ22987,VLACSR,VLCS-H2,VLCSH2
  • Gene Description:
  • solute carrier family 27 (fatty acid transporter), member 5
  • Gene Summary:
  • The protein encoded by this gene is an isozyme of very long-chain acyl-CoA synthetase (VLCS). It is capable of activating very long-chain fatty-acids containing 24- and 26-carbons. It is expressed in liver and associated with endoplasmic reticulum but not with peroxisomes. Its primary role is in fatty acid elongation or complex lipid synthesis rather than in degradation. This gene has a mouse ortholog. [provided by RefSeq
  • Other Designations:
  • fatty-acid-Coenzyme A ligase, very long-chain 3,very long-chain acyl-CoA synthetase homolog 2,very long-chain acyl-CoA synthetase-related protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook