SF3B2 monoclonal antibody (M01J), clone 5D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SF3B2 monoclonal antibody (M01J), clone 5D2. Western Blot analysis of SF3B2 expression in Hela S3 NE.
Western Blot (Cell lysate)
SF3B2 monoclonal antibody (M01J), clone 5D2. Western Blot analysis of SF3B2 expression in Jurkat.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SF3B2 is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to SF3B2 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (31.68 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SF3B2.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
SF3B2 (NP_006833, 592 a.a. ~ 645 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Cell Culture Production
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.68 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SF3B2 monoclonal antibody (M01J), clone 5D2. Western Blot analysis of SF3B2 expression in Hela S3 NE.Western Blot (Cell lysate)
SF3B2 monoclonal antibody (M01J), clone 5D2. Western Blot analysis of SF3B2 expression in Jurkat.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SF3B2 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SF3B2 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — SF3B2
Entrez GeneID
10992GeneBank Accession#
NM_006842Protein Accession#
NP_006833Gene Name
SF3B2
Gene Alias
SAP145, SF3B145, SF3b1, SF3b150
Gene Description
splicing factor 3b, subunit 2, 145kDa
Omim ID
605591Gene Ontology
HyperlinkGene Summary
This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus. [provided by RefSeq
Other Designations
pre-mRNA splicing factor SF3b 145 kDa subunit|spliceosome associated protein 145|splicing factor 3B subunit 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com