COPS6 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human COPS6 partial ORF ( AAH02520, 218 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AEHLIAQHSAIKMLHSRVKLILEYVKASEAGEVPFNHEILREAYALCHCLPVLSTDKFKTDFYDQCNDVGLMAYLGTITKTCNTMNQFVNKFNVLYDRQGIGRRMRGLFF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.95
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — COPS6
Entrez GeneID
10980GeneBank Accession#
BC002520Protein Accession#
AAH02520Gene Name
COPS6
Gene Alias
CSN6, MOV34-34KD
Gene Description
COP9 constitutive photomorphogenic homolog subunit 6 (Arabidopsis)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein belongs to translation initiation factor 3 (eIF3) superfamily. It is involved in the regulation of cell cycle and likely to be a cellular cofactor for HIV-1 accessory gene product Vpr. [provided by RefSeq
Other Designations
COP9 signalosome subunit 6|COP9 subunit 6 (MOV34 homolog, 34 kD)|H_NH0506M12.12|MOV34 homolog, 34 kD
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com