YWHAQ (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human YWHAQ full-length ORF ( AAH56867, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
52.69
Interspecies Antigen Sequence
Rat (99)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — YWHAQ
Entrez GeneID
10971GeneBank Accession#
BC056867Protein Accession#
AAH56867Gene Name
YWHAQ
Gene Alias
14-3-3, 1C5, HS1
Gene Description
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
Omim ID
609009Gene Ontology
HyperlinkGene Summary
This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease. [provided by RefSeq
Other Designations
14-3-3 protein T-cell|14-3-3 protein tau|14-3-3 protein theta|OTTHUMP00000015730|protein tau|tyrosine 3/tryptophan 5 -monooxygenase activation protein, theta polypeptide
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com