STIP1 monoclonal antibody (M02), clone 1B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STIP1.
Immunogen
STIP1 (NP_006810.1, 445 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STIP1 monoclonal antibody (M02), clone 1B10. Western Blot analysis of STIP1 expression in PC-12.Western Blot (Cell lysate)
STIP1 monoclonal antibody (M02), clone 1B10. Western Blot analysis of STIP1 expression in Jurkat.Western Blot (Cell lysate)
STIP1 monoclonal antibody (M02), clone 1B10. Western Blot analysis of STIP1 expression in Raw 264.7.Western Blot (Cell lysate)
STIP1 monoclonal antibody (M02), clone 1B10. Western Blot analysis of STIP1 expression in NIH/3T3.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STIP1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — STIP1
Entrez GeneID
10963GeneBank Accession#
NM_006819Protein Accession#
NP_006810.1Gene Name
STIP1
Gene Alias
HOP, IEF-SSP-3521, P60, STI1, STI1L
Gene Description
stress-induced-phosphoprotein 1
Omim ID
605063Gene Ontology
HyperlinkGene Summary
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM
Other Designations
Hsp70/Hsp90-organizing protein|stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Utilization of HEPES for Enhancing Protein Transfection into Mammalian Cells.
Chen SH, Chao A, Tsai CL, Sue SC, Lin CY, Lee YZ, Hung YL, Chao AS, Cheng AJ, Wang HS, Wang TH.
Molecular Therapy. Methods & Clinical Development 2018 Dec; 13:99.
Application:Flow Cyt, IF, WB-Tr, Human, Mouse, HeLa, Mouse ovarian surface epithelial cancer cells.
-
Utilization of HEPES for Enhancing Protein Transfection into Mammalian Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com