TOMM34 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TOMM34 MaxPab rabbit polyclonal antibody. Western Blot analysis of TOMM34 expression in mouse testis.
Western Blot (Cell lysate)
TOMM34 MaxPab rabbit polyclonal antibody. Western Blot analysis of TOMM34 expression in Hela S3 NE.
Western Blot (Transfected lysate)
Western Blot analysis of TOMM34 expression in transfected 293T cell line (H00010953-T02) by TOMM34 MaxPab polyclonal antibody.
Lane 1: TOMM34 transfected lysate(34.6 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TOMM34 transfected lysate using anti-TOMM34 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TOMM34 purified MaxPab mouse polyclonal antibody (B01P) (H00010953-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TOMM34 protein.
Immunogen
TOMM34 (NP_006800.2, 1 a.a. ~ 309 a.a) full-length human protein.
Sequence
MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (88); Rat (88)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TOMM34 MaxPab rabbit polyclonal antibody. Western Blot analysis of TOMM34 expression in mouse testis.Western Blot (Cell lysate)
TOMM34 MaxPab rabbit polyclonal antibody. Western Blot analysis of TOMM34 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of TOMM34 expression in transfected 293T cell line (H00010953-T02) by TOMM34 MaxPab polyclonal antibody.
Lane 1: TOMM34 transfected lysate(34.6 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TOMM34 transfected lysate using anti-TOMM34 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TOMM34 purified MaxPab mouse polyclonal antibody (B01P) (H00010953-B01P). -
Gene Info — TOMM34
Entrez GeneID
10953GeneBank Accession#
NM_006809.4Protein Accession#
NP_006800.2Gene Name
TOMM34
Gene Alias
HTOM34P, TOM34, URCC3
Gene Description
translocase of outer mitochondrial membrane 34
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats. [provided by RefSeq
Other Designations
OTTHUMP00000031079|mitochondrial import receptor subunit TOM34|outer mitochondrial membrane translocase (34kD)
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com