Product Browser

Last updated: 2017/9/24
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SEC61B purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00010952-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SEC61B protein.
  • Immunogen:
  • SEC61B (NP_006799.1, 1 a.a. ~ 96 a.a) full-length human protein.
  • Sequence:
  • MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SEC61B expression in transfected 293T cell line (H00010952-T02) by SEC61B MaxPab polyclonal antibody.

    Lane 1: SEC61B transfected lysate(10.00 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • SEC61B
  • Gene Alias:
  • -
  • Gene Description:
  • Sec61 beta subunit
  • Gene Summary:
  • The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021784,Sec61 complex, beta subunit,protein translocation complex beta,protein transport protein SEC61 beta subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook