SEC61B purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SEC61B expression in transfected 293T cell line (H00010952-T02) by SEC61B MaxPab polyclonal antibody.
Lane 1: SEC61B transfected lysate(10.00 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SEC61B protein.
Immunogen
SEC61B (NP_006799.1, 1 a.a. ~ 96 a.a) full-length human protein.
Sequence
MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SEC61B expression in transfected 293T cell line (H00010952-T02) by SEC61B MaxPab polyclonal antibody.
Lane 1: SEC61B transfected lysate(10.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SEC61B
Entrez GeneID
10952GeneBank Accession#
NM_006808.2Protein Accession#
NP_006799.1Gene Name
SEC61B
Gene Alias
-
Gene Description
Sec61 beta subunit
Omim ID
609214Gene Ontology
HyperlinkGene Summary
The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the beta-subunit protein. The Sec61 subunits are also observed in the post-ER compartment, suggesting that these proteins can escape the ER and recycle back. There is evidence for multiple polyadenylated sites for this transcript. [provided by RefSeq
Other Designations
OTTHUMP00000021784|Sec61 complex, beta subunit|protein translocation complex beta|protein transport protein SEC61 beta subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com