MSL3L1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MSL3L1 partial ORF ( NP_523353.1, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVVVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDEN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
34.43
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MSL3
Entrez GeneID
10943GeneBank Accession#
NM_078629Protein Accession#
NP_523353.1Gene Name
MSL3
Gene Alias
DKFZp586J1822, MSL3L1
Gene Description
male-specific lethal 3 homolog (Drosophila)
Omim ID
300609Gene Ontology
HyperlinkGene Summary
This gene encodes a nuclear protein and has similarity to drosophila male-specific lethal-3 gene. The drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus this encoded protein is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation. There are four alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000022911|OTTHUMP00000022912|drosophila MSL3-like 1|male-specific lethal 3-like 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com