COPS8 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human COPS8 protein.
Immunogen
COPS8 (NP_006701.1, 1 a.a. ~ 209 a.a) full-length human protein.
Sequence
MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
COPS8 MaxPab polyclonal antibody. Western Blot analysis of COPS8 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of COPS8 expression in transfected 293T cell line (H00010920-T02) by COPS8 MaxPab polyclonal antibody.
Lane 1: COPS8 transfected lysate(22.99 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to COPS8 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — COPS8
Entrez GeneID
10920GeneBank Accession#
NM_006710.4Protein Accession#
NP_006701.1Gene Name
COPS8
Gene Alias
COP9, CSN8, MGC1297, MGC43256, SGN8
Gene Description
COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
COP9 signalosome subunit 8
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com