Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EDAR (Human) Recombinant Protein (Q01)

  • Catalog # : H00010913-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EDAR partial ORF ( NP_071731, 64 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.39
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00010913-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • EDAR
  • Gene Alias:
  • DL,ED1R,ED3,ED5,EDA-A1R,EDA1R,EDA3,FLJ94390
  • Gene Description:
  • ectodysplasin A receptor
  • Gene Summary:
  • This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq
  • Other Designations:
  • downless, mouse, homolog of,ectodysplasin 1, anhidrotic receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook