Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EDAR (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00010913-H02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified EDAR (AAH93872.1, 27 a.a. - 183 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293H cells
  • Sequence:
  • EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKELSGQGH
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 22.55
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-EDAR plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Gene Name:
  • EDAR
  • Gene Alias:
  • DL,ED1R,ED3,ED5,EDA-A1R,EDA1R,EDA3,FLJ94390
  • Gene Description:
  • ectodysplasin A receptor
  • Gene Summary:
  • This gene encodes a member of the tumor necrosis factor receptor family. The encoded transmembrane protein is a receptor for the soluble ligand ectodysplasin A, and can activate the nuclear factor-kappaB, JNK, and caspase-independent cell death pathways. It is required for the development of hair, teeth, and other ectodermal derivatives. Mutations in this gene result in autosomal dominant and recessive forms of hypohidrotic ectodermal dysplasia. [provided by RefSeq
  • Other Designations:
  • downless, mouse, homolog of,ectodysplasin 1, anhidrotic receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook