SUGT1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SUGT1 MaxPab polyclonal antibody. Western Blot analysis of SUGT1 expression in human pancreas.
Western Blot (Transfected lysate)
Western Blot analysis of SUGT1 expression in transfected 293T cell line (H00010910-T01) by SUGT1 MaxPab polyclonal antibody.
Lane 1: SUGT1 transfected lysate(36.63 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SUGT1 protein.
Immunogen
SUGT1 (NP_006695.1, 1 a.a. ~ 333 a.a) full-length human protein.
Sequence
MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (86)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SUGT1 MaxPab polyclonal antibody. Western Blot analysis of SUGT1 expression in human pancreas.Western Blot (Transfected lysate)
Western Blot analysis of SUGT1 expression in transfected 293T cell line (H00010910-T01) by SUGT1 MaxPab polyclonal antibody.
Lane 1: SUGT1 transfected lysate(36.63 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SUGT1
Entrez GeneID
10910GeneBank Accession#
NM_006704Protein Accession#
NP_006695.1Gene Name
SUGT1
Gene Alias
SGT1
Gene Description
SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
Omim ID
604098Gene Ontology
HyperlinkGene Summary
This gene is homologous to the yeast gene SGT1, which encodes a protein involved in kinetochore function and required for the G1/S and G2/M transitions. Complementation studies suggest that the human protein has similar functions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000040878|OTTHUMP00000178679|SGT1B protein|suppressor of G2 allele of SKP1|suppressor of G2 allele of SKP1, S. cerevisiae, homolog of
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com