PPARGC1A monoclonal antibody (M12), clone 3G11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.
Immunogen
PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PPARGC1A monoclonal antibody (M12), clone 3G11. Western Blot analysis of PPARGC1A expression in human spleen.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPARGC1A is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — PPARGC1A
Entrez GeneID
10891GeneBank Accession#
NM_013261Protein Accession#
NP_037393Gene Name
PPARGC1A
Gene Alias
LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1
Gene Description
peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Omim ID
604517Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. [provided by RefSeq
Other Designations
OTTHUMP00000123372|PPAR gamma coactivator variant form|PPAR gamma coactivator-1|ligand effect modulator-6|peroxisome proliferative activated receptor, gamma, coactivator 1, alpha
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Transcutaneous carbon dioxide application accelerates muscle injury repair in rat models.
Akahane S, Sakai Y, Ueha T, Nishimoto H, Inoue M, Niikura T, Kuroda R.
International Orthopaedics 2017 Feb; 41(5):1007.
Application:IF, IHC, Rat, Rat skeletal muscle.
-
AICAR induces mitochondrial apoptosis in human osteosarcoma cells through an AMPK-dependent pathway.
Morishita M, Kawamoto T, Hara H, Onishi Y, Ueha T, Minoda M, Katayama E, Takemori T, Fukase N, Kurosaka M, Kuroda R, Akisue T.
International Journal of Oncology 2017 Jan; 50(1):23.
Application:WB, Human, Osteosarcoma cell lines MG63, KHOS.
-
Transcutaneous carbon dioxide application accelerates muscle injury repair in rat models.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com