Product Browser

Last updated: 2017/10/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPARGC1A polyclonal antibody (A01)

  • Catalog # : H00010891-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PPARGC1A.
  • Immunogen:
  • PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00010891-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PPARGC1A
  • Gene Alias:
  • LEM6,PGC-1(alpha),PGC-1v,PGC1,PGC1A,PPARGC1
  • Gene Description:
  • peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
  • Gene Summary:
  • The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000123372,PPAR gamma coactivator variant form,PPAR gamma coactivator-1,ligand effect modulator-6,peroxisome proliferative activated receptor, gamma, coactivator 1, alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook